PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00224_0130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 552aa    MW: 59466.3 Da    PI: 4.9036
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00224_0130genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.11e-083077148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd+ll   v+ +G g W +  ++ g+ R++ +c  r++ +l
    kfl00224_0130 30 RGPWSAEEDDLLRLFVQAYGDGVWGSAKEKAGLQRSATSCARRYRHFL 77
                     89************************999999************9886 PP

2Myb_DNA-binding315.7e-1085128348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      + T+eE ++++ + k+lG++ W+ Ia+ ++ gR +  +ks++ ++l
    kfl00224_0130  85 PITEEEGDRILSLQKELGNK-WSMIAKQLP-GRNGHAVKSWFDNHL 128
                      569*****************.*********.**********98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-132482IPR009057Homeodomain-like
PROSITE profilePS500908.6292577IPR017877Myb-like domain
SMARTSM007177.7E-62979IPR001005SANT/Myb domain
SuperFamilySSF466896.64E-2229123IPR009057Homeodomain-like
PfamPF002492.0E-73074IPR001005SANT/Myb domain
CDDcd001674.51E-63277No hitNo description
PROSITE profilePS5129416.32178134IPR017930Myb domain
SMARTSM007171.2E-682130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-1383129IPR009057Homeodomain-like
CDDcd001678.27E-685128No hitNo description
PfamPF002493.4E-786128IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MNEISGESSS NVEESHGAPQ SSDQKTFLKR GPWSAEEDDL LRLFVQAYGD GVWGSAKEKA  60
GLQRSATSCA RRYRHFLDPS LKSEPITEEE GDRILSLQKE LGNKWSMIAK QLPGRNGHAV  120
KSWFDNHLAG RPSKRPKCAA PPPSQNASSM LPANEAYFIP EQSNQPVAPI PKHEPPDPIA  180
YWQHLPLPPP PNVPPAPRPP APFHAPHFAP TLRCAARACG GRSRPLTVQL PLAPTTFAPP  240
PQPLFPSVPF PDPQFPDWHP SVPFPVAQPG NEVLPVGSFS APPLDLYSRP SSANPLALPP  300
PVLQWLAHSQ PIANGSNGLP TPFPMTYAPA AFAEGPHARD AAAASAPLTP LLGPSTHKAS  360
KEQKGDHSGL RLEIGSPPGP FVNVLGTDPL TPEGNKTQVG EEPRSAPVDS FPSELEDLDL  420
TGWPSEAPEP QGGGTQGFTN ASASADRWAE EDCRQTEAGD FQCDEQGLGS SEEGVFPARS  480
PPSFSEMDDT AGGMTESQKV ARRAVEEERA RLFEALDPDC KRVCRSEELM AAARALDEEQ  540
SRLFSVLEDQ GR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-14281282101C-Myb DNA-Binding Domain
1mse_C1e-14281282101C-Myb DNA-Binding Domain
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.17e-27myb domain protein 82